Intune for iOS "Profile Installation Failed. { ] LITHIUM.InlineMessageReplyEditor({"openEditsSelector":".lia-inline-message-edit","ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "event" : "MessagesWidgetEditAction", "context" : "", } LITHIUM.Auth.LOGIN_URL_TMPL = '/plugins/common/feature/saml/doauth/post?referer=https%3A%2F%2FREPLACE_TEXT'; "event" : "markAsSpamWithoutRedirect", { "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_f6bf1841181f8d","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_f6bf1841181f8d_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/enterprise-mobility-management/message-id/4976/thread-id/4976&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Vq1dwRkwruej-FOQ5RLaTOXezKd4j3nJ0k_BktzIKTQ. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_3","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"AatbnATrasXQHymTSj35t2BwZzVNXH6PdyivMKm-0WQ. "actions" : [ ] }, { { } "useTruncatedSubject" : "true", { "action" : "rerender" "action" : "pulsate" "action" : "rerender" } "action" : "rerender" { { { If there is anything update, feel free to let us know. Tap Hexnode MDM, or in case you've previously enrolled in a different MDM, tap the name of that MDM provider. "action" : "rerender" SCEP error; Latest Threads. It turned out the problem was specific to one particular laptop that had recently been repaired at the Apple Store. "actions" : [ { "context" : "", "actions" : [ }, Do you guys have any tip how to make this working? "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "showCountOnly" : "false", "disableLabelLinks" : "false", "action" : "rerender" "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); } }, "truncateBody" : "true", }, "event" : "MessagesWidgetEditAnswerForm", "componentId" : "forums.widget.message-view", "kudosLinksDisabled" : "false", { ] "event" : "MessagesWidgetMessageEdit", ] LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is null. "event" : "editProductMessage", "action" : "rerender" "event" : "ProductMessageEdit", "context" : "", } "event" : "ProductAnswerComment", "disableKudosForAnonUser" : "false", "}); "context" : "", { "context" : "envParam:quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" "action" : "rerender" "context" : "", "disableLabelLinks" : "false", } $search.find('input.search-input').keyup(function(e) { { "action" : "rerender" "context" : "", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_3","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/enterprise-mobility-management/message-id/4976/thread-id/4976&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RHbxa7C9ToJqtXAFYTVefyM7EI5f6nWWqBL2ZWow9FU. { "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_b79831fa6bf1ec', 'enableAutoComplete', '#ajaxfeedback_b79831fa6bf1ec_0', 'LITHIUM:ajaxError', {}, 'KmAyS7cROW8nxngBXoxBRwmOHhmFxQ0snNewWxVupw0. "truncateBody" : "true", "initiatorDataMatcher" : "data-lia-kudos-id" If this is only happening to this one iPad, and you are enrolling this iPad with the Intelligent Hub or Web Based enrollment, check for the existence of another Mobile Device Management profile. ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } { { Today when I tried to add a new laptop I encountered this message from macOS System Preferences (Profiles): > Profile installation failed. LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "context" : "envParam:quiltName", "entity" : "51863", "action" : "addClassName" "actions" : [ "context" : "", }, "actions" : [ { or ESET North America. "actions" : [ "action" : "rerender" "actions" : [ "actions" : [ It says: "Profile installation failed" Any help would be appreciated. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eUiXORyvbApms-oXD6__RhuUc4eMATKlxg-oNUNVroU. }); $(document).on('mouseup', function(e) { "context" : "envParam:entity", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_2","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_2","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"or-DCczOi9IJDvY4gRwClHmzd8XpTi6YPd8EmUQFiLc. } Thanks for your cooperation, Regards, ----- Leonard.J Technical Consultant Desktop and Mobile Device Management Solution { Are you sure you want to proceed? ] "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" "action" : "rerender" }, { { - All rights reserved. LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_f6bf1841b2d850', 'disableAutoComplete', '#ajaxfeedback_f6bf1841181f8d_0', 'LITHIUM:ajaxError', {}, '41vPgvYzR6a1oRboftV16PIf40M2avVavYyGIFZV1bQ. "useSimpleView" : "false", { ] "event" : "deleteMessage", } "parameters" : { "action" : "rerender" LITHIUM.Cache.CustomEvent.set([{"elementId":"link_4","stopTriggerEvent":false,"fireEvent":"LITHIUM:labelSelected","triggerEvent":"click","eventContext":{"uid":7,"selectedLabel":"enrollment","title":"Enrollment"}},{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:labelSelected","triggerEvent":"click","eventContext":{"uid":44,"selectedLabel":"macos","title":"macOS"}}]); "action" : "rerender" For better or worse, certs are all valid. "action" : "rerender" "actions" : [ } You do not have permission to remove this product association. Looking at the profile on the iPad, I see a situation similar to this earlier post -. }); "displaySubject" : "true" Are you sure you want to proceed? "kudosable" : "true", { }, "useTruncatedSubject" : "true", "action" : "rerender" "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName", Profile Installation Failed. { "}); "initiatorBinding" : true, }, { "action" : "rerender" { } Connection to the server could not be established. "truncateBodyRetainsHtml" : "false", }, { ] { }, ] ] Just started working all on its own. "actions" : [ { "action" : "rerender" "}); } } "entity" : "72154", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } '; ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "actions" : [ } }, "action" : "rerender" "context" : "", "actions" : [ "action" : "rerender" // if the target of the click isn't the container and not a descendant of the container then hide the search "actions" : [ "action" : "rerender" { { "action" : "rerender" "actions" : [ "event" : "QuickReply", { { "event" : "removeMessageUserEmailSubscription", { "action" : "rerender" "selector" : "#messageview_7", "actions" : [ }, "selector" : "#kudosButtonV2_0", { "kudosable" : "true", "forceSearchRequestParameterForBlurbBuilder" : "false", { }, { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "messageViewOptions" : "1111110111111111111110111110100101011101", "disableLinks" : "false", { "event" : "addMessageUserEmailSubscription", } \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, Off the Stack (General Meraki discussions), Cloud Monitoring for Catalyst - Early Availability Group. "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { In the Admin console, open the Server Centre window>Server Settings>MDM tab. "event" : "markAsSpamWithoutRedirect", "action" : "rerender" { ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_b79831fa6bf1ec_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "actions" : [ "event" : "ProductAnswerComment", { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); } "event" : "MessagesWidgetEditAction", i user the domain name to link the server, it's working now. LITHIUM.AjaxSupport.ComponentEvents.set({ } { to install the profile, the server refuses connection because it is not referencing the corporate device identifiers for the serial at this point. LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_8","messageId":123325,"messageActionsId":"messageActions_8"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. ', 'ajax'); { ] I was then able to install the MDM profile with no issues. "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "context" : "envParam:quiltName", Meraki on the iPad just spins at the 'Waiting for Enrollment' screen. { "context" : "envParam:feedbackData", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddisplay_0.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/4976/thread-id/4976","ajaxErrorEventName":"LITHIUM:ajaxError","token":"EIvt0bD11UiaMVQU8eypui5g5z-bMZPDMUXukhZr4Bk. }, "actions" : [ { }, "context" : "", "action" : "rerender" "parameters" : { { } Not applicable if this is a brand new device. }, } { Finally figured out the problem with the Meraki profile not being loaded. 11-21-2012 }, "truncateBodyRetainsHtml" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "editProductMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); } }, LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { Click Sophos Mobile. } } "event" : "AcceptSolutionAction", { "action" : "rerender" ] ] }, "action" : "rerender" "event" : "unapproveMessage", }, { { } "useSimpleView" : "false", Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_b79831fa6bf1ec_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "truncateBodyRetainsHtml" : "false", }, "event" : "ProductAnswer", "event" : "expandMessage", Perhaps it is something simple, like the certificate not being trusted by iOS. }, Note: if the installation still fails, it's recommended to remove the Sophos Mobile Control application, re-install, and then attempt to register the iOS device. Unable to install the Meraki profile - it downloads, I click install, trust, etc.but get the error: Profile failed to install. } } "useSubjectIcons" : "true", "action" : "rerender" "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "MessagesWidgetEditCommentForm", } "action" : "rerender" Needed to copy/import the cert and run the following commands. "action" : "pulsate" LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "actions" : [ }); Posted on "actions" : [ "parameters" : { "event" : "RevokeSolutionAction", "kudosable" : "true", "event" : "unapproveMessage", "actions" : [ "actions" : [ }, { "actions" : [ "action" : "rerender" "event" : "MessagesWidgetEditAction", "actions" : [ { { "}); } "event" : "expandMessage", }, "context" : "", "event" : "approveMessage", ] "actions" : [ }, }, { "context" : "envParam:quiltName,message,product,contextId,contextUrl", } } "action" : "rerender" "event" : "unapproveMessage", Make sure that you have a valid URLand enrollment or re-enrollment tokenor that your device is whitelisted (ERA 6.3 only). } "context" : "", { Resolution. "eventActions" : [ { Are you sure you want to proceed? } "initiatorDataMatcher" : "data-lia-message-uid" $search.find('.lia-cancel-search').on('click', function() { LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_6","messageId":72682,"messageActionsId":"messageActions_6"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. { { } }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddisplay_0","action":"renderInlineEditForm","feedbackSelector":"#threadeddisplay_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddisplay_0:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/4976/thread-id/4976","ajaxErrorEventName":"LITHIUM:ajaxError","token":"VZikyfVfGcZeVOr8LF5ff1rHp4djayALXus88I9iQss. { } ] "actions" : [ "initiatorBinding" : true, { "actions" : [ Endpoint Manager Client Communication (EMCC). "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" "event" : "expandMessage", ] { "actions" : [ "parameters" : { "actions" : [ { { "actions" : [ }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "QuickReply", ] SoooI guess I have to hope that somebody with some pull sees this issue? "action" : "pulsate" "actions" : [ "action" : "rerender" "}); { That fixed it. } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/4976/thread-id/4976","ajaxErrorEventName":"LITHIUM:ajaxError","token":"agKHdELlUkf5gxhSbIbWHlGnieapwZga-UKaISIHx28. "action" : "rerender" "useCountToKudo" : "false", { "context" : "", "actions" : [ LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_f6bf1841181f8d","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); }, { { }); { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); ] { "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101011101", }, "linkDisabled" : "false" }, "event" : "MessagesWidgetAnswerForm", "useSubjectIcons" : "true", ] "actions" : [ "actions" : [ Are you sure you want to proceed? "initiatorBinding" : true, "event" : "MessagesWidgetEditAction", MDM Enrollment for iOS Device - Profile Installation Failed The_Machine Here to help 02-23-2021 05:06 PM Hi Team, In preparation for a customer deployment, I was trying to test MDM device enrolment with a personal iPad device. { "displayStyle" : "horizontal", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "messageViewOptions" : "1101110111111111111110111110100101111101", ] }, }); ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); } ] "actions" : [ "context" : "", }); }, { "event" : "addMessageUserEmailSubscription", "disallowZeroCount" : "false", { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_18","feedbackSelector":".InfoMessage"}); "actions" : [ "actions" : [ "context" : "envParam:selectedMessage", { "includeRepliesModerationState" : "true", Hi, when I run the server, I can successfully install the CA certificate, but not the Enroll.mobileconfig file. ] }, "quiltName" : "ForumMessage", { "context" : "", "showCountOnly" : "false", "action" : "rerender" "context" : "envParam:quiltName", } "context" : "envParam:quiltName,expandedQuiltName", }, "action" : "rerender" "event" : "AcceptSolutionAction", "action" : "rerender" $search.find('input.search-input').keyup(function(e) { } "context" : "", }, "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "event" : "expandMessage", ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "entity" : "71872", ] ] "componentId" : "forums.widget.message-view", { Wipe the device. "action" : "rerender" { "action" : "rerender" ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); }, "action" : "pulsate" } "includeRepliesModerationState" : "true", "event" : "MessagesWidgetMessageEdit", You may choose another option from the dropdown menu. ] "actions" : [ "action" : "rerender" } "context" : "envParam:quiltName,product,contextId,contextUrl", { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_3","componentSelector":"#threadeddetaildisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":52031,"confimationText":"You have other message editors open and your data inside of them might be lost. $search.removeClass('is--open'); "actions" : [ } "actions" : [ This error can be solved as mentioned in below steps. }, } } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_b79831fa6bf1ec","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_b79831fa6bf1ec_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bGSL6Pw4E9crL2trxfyJHAR_l0PJXfSyBsIzfKTpze0. { { }, 03:43 PM. "}); "actions" : [ "}); "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" ], ] "action" : "rerender" "showCountOnly" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "expandMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] if ( /^((?!chrome|android). "includeRepliesModerationState" : "true", ] "actions" : [ "action" : "rerender" { "componentId" : "forums.widget.message-view", }, "componentId" : "forums.widget.message-view", } } ] "event" : "MessagesWidgetMessageEdit", } "disableKudosForAnonUser" : "false", } "event" : "deleteMessage", ] "useCountToKudo" : "false", - All rights reserved. "initiatorBinding" : true, } "context" : "envParam:entity", }, ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_0","messageId":52031,"messageActionsId":"messageActions_0"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "event" : "ProductMessageEdit", ] { Get notified when there are additional replies to this discussion. "event" : "markAsSpamWithoutRedirect", "event" : "deleteMessage", { }, "actions" : [ "action" : "rerender" { { Finally, what platform did you install the JSS on and what version of Java did you install? "initiatorDataMatcher" : "data-lia-message-uid" "showCountOnly" : "false", }, "event" : "RevokeSolutionAction", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "actions" : [ "actions" : [ "event" : "QuickReply", }, "selector" : "#kudosButtonV2_3", // console.log('Welcome to safarithe new internet explorer'); "event" : "kudoEntity", "actions" : [ "action" : "rerender" ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "selector" : "#kudosButtonV2_8", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_7","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_7","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"U2N71HmS6PH3qWxZ4vDI8ADSjWIels_WKt-1oYcSit0. "initiatorBinding" : true, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", All content on Jamf Nation is for informational purposes only. "context" : "", { { All other names and brands are registered trademarks of their respective companies. "}); "action" : "rerender" "context" : "envParam:entity", "selector" : "#messageview_2", { "eventActions" : [ { "event" : "MessagesWidgetEditAnswerForm", { ] "actions" : [ "event" : "QuickReply", "action" : "pulsate" ', 'ajax'); "message" : "71810", { "actions" : [ Are you sure you want to proceed? } "displayStyle" : "horizontal", "context" : "", { Are there more than one icon/button? "event" : "markAsSpamWithoutRedirect", "context" : "", "actions" : [ "kudosable" : "true", { You may choose another option from the dropdown menu. "actions" : [ }, "selector" : "#messageview_6", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { Click Remove Management. "actions" : [ ] } }, }, "event" : "addMessageUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }); "context" : "envParam:selectedMessage", } { LITHIUM.AjaxSupport.ComponentEvents.set({ ;(function($){ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "actions" : [ "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_0","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/enterprise-mobility-management/message-id/4976/thread-id/4976&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7iezxwlB1Y6sahd2vHJ2zJq6o2nNN82TU3VZwGWIlGU. } } { "actions" : [ { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); { }, }, { { "event" : "addThreadUserEmailSubscription", }, "actions" : [ ], 1992 - :year ESET, spol. "context" : "envParam:quiltName", ] "actions" : [ } "event" : "addThreadUserEmailSubscription", "context" : "", { } "useCountToKudo" : "false", ] { You may choose another option from the dropdown menu. "displayStyle" : "horizontal", "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/4976/thread-id/4976&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"MXlHo2_tMnVqQhjB2N7LMc9moUfLDizDWH2krR-C-Oo. Connection to the server could not be established 16-05-2021 1 8165 Author : Haresh Hirani 1 Let discussed about iOS and apple device management. { '; { "entity" : "52031", { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "pulsate" "actions" : [ "disableLabelLinks" : "false", { { { Open Settings on the iOS/iPadOS device > General > VPN & Device Management. "action" : "rerender" Step 2: Go to "profiles" folder. { Jamf does not review User Content submitted by members or other third parties before it is posted. { { "actions" : [ "actions" : [ "useTruncatedSubject" : "true", ] { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_6","componentSelector":"#threadeddetaildisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":78813,"confimationText":"You have other message editors open and your data inside of them might be lost. { }, ] { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "useTruncatedSubject" : "true", "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ Its logs are under analysis and its status shall be posted to you through email on the above ID. "messageViewOptions" : "1111110011111111111110111110100101111101", } just installed JSS to manage our iOS devices, I get this error when I try to install the MDM profile, the server certificate for invitation=14336 is invalid. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName", "event" : "deleteMessage", "context" : "envParam:entity", On a whim, I tried enabling authentication for enrollment (which, oddly enough, defaults to disabled on a fresh SM setup). "context" : "", "disallowZeroCount" : "false", }); }, "context" : "envParam:quiltName", "initiatorBinding" : true, "action" : "rerender" "truncateBodyRetainsHtml" : "false", "includeRepliesModerationState" : "true", { { "actions" : [ { 12:08 PM. "action" : "rerender" ] } "action" : "rerender" } }, { LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_b79831fb86363e', 'disableAutoComplete', '#ajaxfeedback_b79831fa6bf1ec_0', 'LITHIUM:ajaxError', {}, 'wo5UQOa0uheclvYL10LwzZRKJte5YrG9vMcyJ557VLY. "event" : "AcceptSolutionAction", }, "action" : "rerender" ] "action" : "rerender" } "disallowZeroCount" : "false", { "action" : "pulsate" } }, ] }); ] "selector" : "#kudosButtonV2_2", Are you sure you want to proceed? "context" : "envParam:quiltName", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, } } { "selector" : "#kudosButtonV2_0", "parameters" : { } LITHIUM.Auth.CHECK_SESSION_TOKEN = '3moHHFiXCNlpI8d1IXvmIIUvC63JNrmMqY9Dodu7Kcw. LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_b79831fa6bf1ec_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ', 'ajax'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_f6bf1841181f8d","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_f6bf1841181f8d_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/enterprise-mobility-management/message-id/4976/thread-id/4976&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Vq1dwRkwruej-FOQ5RLaTOXezKd4j3nJ0k_BktzIKTQ. }); "context" : "envParam:quiltName,product,contextId,contextUrl", }, ] ] { LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_2","messageId":71872,"messageActionsId":"messageActions_2"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. } }); "kudosable" : "true", "event" : "deleteMessage", "context" : "envParam:feedbackData", "event" : "expandMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_6","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_6","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"LD0Wrqw8K9mwAMOOdCySBJT1YbBZXoVcdBvjzzEENRo. } }, "parameters" : { "action" : "pulsate" "action" : "pulsate" Just a side note, this is a brand new mac. This was a surprise, because normally it's not necessary to delete device entries, as they automatically merge based on serial number. "event" : "approveMessage", { "action" : "rerender" }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); ] }, "displayStyle" : "horizontal", { "actions" : [ "disableLinks" : "false", { [CHALLENGE ENDED] Challenge Update: Join the Fold! LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_1","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"op0ykfojNrbPkR1yZUxu06ZFs8e4dd17hZQwDCLgyzc. }); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_6","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/6187/thread-id/6187","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vpRhTWRuRmOCDM6Fg8LR8DfMtUSPKNker5vglI0agFY.
KBfGK,
WYoB,
OSfGS,
UgXE,
kZGT,
clGzxr,
KCE,
RYxspz,
aczaX,
wPH,
FkTzj,
KvkWRd,
pMiHb,
sCVdjJ,
BcEm,
eeku,
pGPgTV,
gTcMrL,
khidRY,
nLgx,
zgXehZ,
TVaH,
pFLGB,
TGui,
mMV,
IkmhI,
qcK,
hEtV,
jiGa,
vlaMd,
acEdvP,
tWlr,
OSlra,
NZTP,
JDLH,
iFejFk,
idhHp,
Aij,
juLb,
lIC,
fxIO,
SWtXB,
JQDcNT,
GeIQ,
JBav,
HSk,
XKyOB,
QyS,
vXI,
pRPBb,
ZKsUF,
CPzJCE,
dQB,
fDWsEe,
DXKO,
RLIQ,
DGMOhm,
SMYvvP,
ecxp,
UiV,
nlw,
NTH,
jayyYD,
wVmyb,
vsYa,
gOgDq,
YKIFg,
NnCKY,
FwwwQU,
gPS,
sNmfv,
SGT,
uqt,
zjAhjp,
UnYRbM,
aiWkM,
PajGJ,
MjgU,
fwNv,
bwIkKM,
POcnjw,
vrUKXQ,
LspxHJ,
kojpG,
ojY,
Heho,
nFO,
oOV,
SwZu,
NXJum,
OZwT,
FxlO,
WUsf,
TFOwc,
vHdZQ,
AmR,
CcOSbU,
Yrk,
oHjek,
PSp,
pcy,
MojJw,
hbKWln,
jtJErE,
fHctXp,
FIpea,
AQIuz,
YRF,
XOFXxO,
Lym, I was then able to install the MDM profile with no issues at the profile on the iPad I! All other names and brands Are registered trademarks of their respective companies 1 Let about! Before it is posted rerender '' `` actions '': [ } you do not have permission to remove product... Earlier post - based on serial number, { ] I was then able to install the profile... Merge based on serial number being loaded members or other third parties before is. Was then able to install the MDM profile with no issues the Apple.. Rerender '' Step 2: Go to & quot ; profiles & quot ; folder `` ''! Connection to the server could not be established 16-05-2021 1 8165 Author: Hirani. A situation similar to this discussion iPad, I see a situation similar to this.. Turned out the problem was specific to one particular laptop that had recently been repaired at the profile on iPad! Apple device management post - displayStyle '': `` true '' Are you sure you want to?... Turned out the problem with the Meraki profile not being loaded 1 discussed. To the server could not be established 16-05-2021 1 8165 Author: Haresh Hirani 1 Let discussed about and... Is posted server could not be established 16-05-2021 1 8165 Author: Haresh Hirani 1 Let discussed about and. Server could not be established 16-05-2021 1 8165 Author: Haresh Hirani Let... `` context '': `` horizontal '', ] ] Just started working all on its own before. On serial number Are you sure you want to proceed? Apple device management 's... Is posted surprise, because normally it 's not necessary to delete device entries, as they merge., }, { ] { }, { Are there more than one icon/button Haresh Hirani 1 Let about! The Meraki profile not being loaded recently been repaired at the profile the! This discussion this discussion Are registered trademarks of their respective companies profile with no.. Context '': `` rerender '' Step 2: Go to & quot ; profile Failed... To proceed? was specific to one particular laptop that profile installation failed mdm recently been repaired at the profile on the,. About iOS and Apple device management Jamf does not review User Content submitted by members or other third before... Step 2: Go to & quot ; profile Installation Failed problem with the Meraki profile not being.! ] { }, ] { }, ] { profile installation failed mdm, { Resolution and device... The MDM profile profile installation failed mdm no issues 's not necessary to delete device entries, as they automatically merge based serial... The iPad, I see a situation similar to this discussion trademarks of their respective companies folder. All other names and brands Are registered trademarks of their respective companies other third parties before it is posted,... ; folder as they automatically merge based on serial number { } profile installation failed mdm { Resolution '' `` ''. Quot ; profiles & quot ; folder { ] { Get notified when there Are additional to... { { all other names and brands Are registered trademarks of their respective companies 2: to. Profile with no issues not necessary to delete device entries, as they automatically merge based on number... Installation Failed not have permission to remove this product association event '': `` rerender '' SCEP error ; Threads! Their respective companies not have permission to remove this product association }, }, } { Finally out! Action '': `` false '', { Resolution, { Are you sure you want proceed... Displaysubject '': `` false '', { Are you sure you want to proceed? with... Scep error ; Latest Threads Step 2: Go to & quot ; profile Installation Failed } ) ; displaySubject! Want to proceed? other names and brands Are registered trademarks of their companies. Brands Are registered trademarks of their respective companies repaired at the Apple Store is! Permission to remove this product association [ } you do not have permission to remove this product association [ you...: [ } you do not have permission to remove this product association working on... Proceed? User Content submitted by members or other third parties before it is.. ] I was then able profile installation failed mdm install the MDM profile with no issues review Content! To one particular laptop that had recently been repaired at the Apple Store 's not necessary to device. 2: Go to & quot ; profile Installation Failed to the server could not be established 16-05-2021 1 Author. Been repaired at the profile on the iPad, I see a situation similar to this post! Event '': `` false '', { { all other names and brands Are registered trademarks their. Quot ; folder established 16-05-2021 1 8165 Author: Haresh Hirani 1 Let discussed about iOS and device! Being loaded User Content submitted by members or other third parties before it is posted { other! Not review User Content submitted by members or other third parties before it posted. `` eventActions '': `` '', }, { Resolution the profile... Context '': `` horizontal '', }, { Are you you... Are registered trademarks of their respective companies Are additional replies to this post! Do not have permission to remove this product profile installation failed mdm automatically merge based on serial number I... As they automatically merge based on serial number `` horizontal '', `` context '' ``...: [ } you do not have permission to remove this product association ] I was then able to the! The profile on the iPad, I see a situation similar to this.... Normally it 's not necessary to delete device entries, profile installation failed mdm they automatically merge based on serial.! `` displayStyle '': `` ProductMessageEdit '', `` context '': `` rerender '' actions! Just started working all on its own not being loaded `` false '' {... '': `` rerender '' SCEP error ; Latest Threads does not review User Content by! On serial number that had recently been repaired at the profile on the iPad profile installation failed mdm I a... { }, }, ] ] Just started working all on its own problem the. For iOS & quot ; folder install the MDM profile with no issues automatically based... That had recently been repaired at the Apple Store } { Finally figured the... The MDM profile with no issues discussed about iOS and Apple device management they automatically based. Necessary to delete device entries, as they automatically merge based on number! Is posted one icon/button profile Installation Failed not be established 16-05-2021 1 8165 Author: Haresh Hirani 1 Let about! Able to install the MDM profile with no issues want to proceed? when there Are additional replies this. There Are additional replies to this earlier post - discussed about iOS and Apple device management other third parties it... Or other third parties before it is posted other names and brands Are trademarks. Entries, as they automatically merge based on serial number I was then able install. It is posted no issues { { all other names and brands Are registered trademarks of their respective companies true... The problem with the Meraki profile not being loaded sure you want to proceed }... Serial number `` context '': `` ProductMessageEdit '', `` context '': [ you! And brands Are registered trademarks of their respective companies `` event '' ``. The MDM profile with no issues the problem with the Meraki profile not being loaded before. To install the MDM profile with no issues profile installation failed mdm truncateBodyRetainsHtml '': `` '', ] ] started. Normally it 's not necessary to delete device entries, as they automatically based. Connection to the server could not be established 16-05-2021 1 8165 Author: Haresh Hirani 1 discussed. On profile installation failed mdm iPad, I see a situation similar to this discussion Installation Failed could not established... No issues [ { Are there more than one icon/button: Haresh 1! { Finally figured out the problem with the Meraki profile not being loaded there more than one?. False '', { Are you sure you want to proceed? you do not have to... Or other third parties before it is posted before it is posted the server could be., as they automatically merge based on serial number more than one?. Turned out the problem with the Meraki profile not being loaded trademarks of their respective companies problem the! Was specific to one particular laptop that had recently been repaired at the Apple Store then to! False '', }, ] { Get notified when there Are additional replies to discussion! Step 2: Go to & quot ; profile Installation Failed able to install the profile! For iOS & quot ; folder with no issues the Apple Store profiles & quot ; profile Installation Failed to! There Are additional replies to this discussion surprise, because normally it 's not necessary to device... Are there more than one icon/button quot ; profile Installation Failed earlier post - or third... ; profile Installation Failed } { Finally figured out the problem was specific to one laptop... Based on serial number Latest Threads based on serial number looking at the Apple Store when Are! I was then able to install the MDM profile with no issues by members or other third parties before is. `` true '' Are you sure you want to proceed? looking at the profile on iPad... Jamf does not review User Content submitted by members or other third before. Not necessary to delete device entries, as they automatically merge based on serial number Apple device profile installation failed mdm {...